PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009907-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 231aa    MW: 26594.1 Da    PI: 7.4108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009907-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.6e-14972148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT................TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg................kgRtlkqcksrwqkyl 48
                     +g WT+eEd+ll+++v+ +G g Wk I+++ g                + R++k+c++rw++yl
    NNU_009907-RA  9 KGCWTEEEDKLLKRCVEIYGEGKWKHIPARAGkldrpkqclvprmnegLDRCRKSCRLRWLNYL 72
                     799***********************************************************97 PP

2Myb_DNA-binding46.77.1e-1578123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E +l+++++k+lG++ W++Ia++++ gRt++++k++w+++l
    NNU_009907-RA  78 RGNFAVDEVDLIIRLHKLLGNR-WSLIAARIP-GRTANDVKNYWNSHL 123
                      7889999***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.672472IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-20574IPR009057Homeodomain-like
SuperFamilySSF466894.77E-256119IPR009057Homeodomain-like
SMARTSM007173.4E-13874IPR001005SANT/Myb domain
PfamPF002491.6E-13972IPR001005SANT/Myb domain
CDDcd001671.63E-91272No hitNo description
PROSITE profilePS5129424.87973127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2375128IPR009057Homeodomain-like
SMARTSM007172.6E-1477125IPR001005SANT/Myb domain
PfamPF002499.1E-1478123IPR001005SANT/Myb domain
CDDcd001672.95E-984123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRMKNYRKG CWTEEEDKLL KRCVEIYGEG KWKHIPARAG KLDRPKQCLV PRMNEGLDRC  60
RKSCRLRWLN YLRPNIKRGN FAVDEVDLII RLHKLLGNRW SLIAARIPGR TANDVKNYWN  120
SHLSKKLKSE QLLPSNLTTQ LAGPQTSAAN SSEWTTGVSD STGGDHQRQV DEEESGEEET  180
LTFWKRLLLE GEEMKTKSSA EDKEMAVNNE DFLVGFEELV QDGEIWSLLS E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2091297110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260713.11e-147PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV93e-51MY113_ARATH; Transcription factor MYB113
TrEMBLD7T9Q42e-60D7T9Q4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g01190.t016e-60(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.13e-52myb domain protein 113